PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy011555
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 454aa    MW: 49801.4 Da    PI: 5.9134
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59553097PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS383.52.6e-117864453374
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                 lLl+cAe+v+ ++l  a+ lL ++ el+sp g++ +R+ ayf++AL+ar+++s+ + y+ l++++ + ++s++ ++a++ ++ vsP++kfsh+taNqaI
  Ahy011555  86 GLLLQCAECVAMDNLDFANDLLPEIAELSSPFGTSPERVGAYFAQALQARVVSSCLGAYSPLTAKSVTLTQSQRIFNAFQSYNSVSPLVKFSHFTANQAI 185
                58******************************************************************99****************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEal 202
                 +a++ge+rvHiiD+di+qGlQWp L++ LasR+++  s+RiTg+gs    s+e le+tg+rLa+fA++lg+pfef+++  k  +  +l++L v+p+Ea+
  Ahy011555 186 FQALDGEDRVHIIDLDIMQGLQWPGLFHILASRSRKIRSMRITGFGS----SSELLESTGRRLADFASSLGLPFEFHPVEGKIGSITDLSQLGVRPNEAI 281
                ***********************************************....9**************************878888888************* PP

       GRAS 203 aVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvaceg 302
                +V++++  h l+d ++s       +L+l+ +l+Pk+++ veq+++h ++sFl+rf+eal+yysalfd+l  +l+++s er++vE++llg ei+n+va  g
  Ahy011555 282 VVHWMH--HCLYDITGSDLG----TLRLLSQLRPKLITTVEQDLSH-AGSFLARFVEALHYYSALFDALGDGLGADSLERHTVEQQLLGCEIRNIVAVGG 374
                ****99..777777777777....**********************.899************************************************** PP

       GRAS 303 aerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 +r+ + + +e+W e l+++GF+pv+l+ + a+qa+lll +++++gy++ ee+gsl lgWkd +L+++SaW+
  Ahy011555 375 PKRTGEVK-VERWGEELRRVGFRPVSLRGNPASQASLLLGMFPWRGYTLVEENGSLKLGWKDLSLLTASAWQ 445
                **998887.9*************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.61558425IPR005202Transcription factor GRAS
PfamPF035148.9E-11586445IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MLQSLVPRSP ITPNPNSMKT KRDRHDATAD SPADEEPSFK RANFSGEKSS AQAVGEAEGH  60
HEEQQQQVLE VAEARGGEST GLKLLGLLLQ CAECVAMDNL DFANDLLPEI AELSSPFGTS  120
PERVGAYFAQ ALQARVVSSC LGAYSPLTAK SVTLTQSQRI FNAFQSYNSV SPLVKFSHFT  180
ANQAIFQALD GEDRVHIIDL DIMQGLQWPG LFHILASRSR KIRSMRITGF GSSSELLEST  240
GRRLADFASS LGLPFEFHPV EGKIGSITDL SQLGVRPNEA IVVHWMHHCL YDITGSDLGT  300
LRLLSQLRPK LITTVEQDLS HAGSFLARFV EALHYYSALF DALGDGLGAD SLERHTVEQQ  360
LLGCEIRNIV AVGGPKRTGE VKVERWGEEL RRVGFRPVSL RGNPASQASL LLGMFPWRGY  420
TLVEENGSLK LGWKDLSLLT ASAWQPSDLI TYPE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-47844454375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016187881.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ10.0SCL23_ARATH; Scarecrow-like protein 23
TrEMBLA0A0L9V7R60.0A0A0L9V7R6_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SED00.0A0A0S3SED0_PHAAN; Uncharacterized protein
STRINGGLYMA11G10220.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.10.0GRAS family protein